Lineage for d1ztec2 (1zte C:84-198)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946003Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2946129Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2946193Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries)
  8. 2946208Domain d1ztec2: 1zte C:84-198 [125646]
    Other proteins in same PDB: d1ztea1, d1zteb1, d1ztec1, d1zted1
    automated match to d2p4ka2
    complexed with mn

Details for d1ztec2

PDB Entry: 1zte (more details), 1.85 Å

PDB Description: contribution to structure and catalysis of tyrosine 34 in human manganese suerpoxide dismutase
PDB Compounds: (C:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d1ztec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztec2 d.44.1.1 (C:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOPe Domain Coordinates for d1ztec2:

Click to download the PDB-style file with coordinates for d1ztec2.
(The format of our PDB-style files is described here.)

Timeline for d1ztec2: