Lineage for d1ztec1 (1zte C:1-83)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979785Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1979786Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 protein domains)
  6. 1979912Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 1979976Species Human (Homo sapiens) [TaxId:9606] [46619] (27 PDB entries)
  8. 1979993Domain d1ztec1: 1zte C:1-83 [125645]
    Other proteins in same PDB: d1ztea2, d1zteb2, d1ztec2, d1zted2
    automated match to d1pl4a1
    complexed with mn

Details for d1ztec1

PDB Entry: 1zte (more details), 1.85 Å

PDB Description: Contribution to Structure and Catalysis of Tyrosine 34 in Human Manganese Suerpoxide Dismutase
PDB Compounds: (C:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d1ztec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztec1 a.2.11.1 (C:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaahvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOPe Domain Coordinates for d1ztec1:

Click to download the PDB-style file with coordinates for d1ztec1.
(The format of our PDB-style files is described here.)

Timeline for d1ztec1: