SCOPe 2.08: Domain d1zteb1: 1zte B:1-83

Lineage for d1zteb1 (1zte B:1-83)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46619] (35 PDB entries)

8. Domain d1zteb1: 1zte B:1-83 [125643]
   Other proteins in same PDB: d1ztea2, d1zteb2, d1ztec2, d1zted2
   automated match to d1pl4a1
   complexed with mn

Details for d1zteb1

PDB Entry: 1zte, 1.85 Å

PDB Description: contribution to structure and catalysis of tyrosine 34 in human manganese suerpoxide dismutase

PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d1zteb1:

Sequence; same for both SEQRES and ATOM records:

>d1zteb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaahvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

Timeline for d1zteb1:

• d1zteb1 first appeared in SCOP 1.73
  
• d1zteb1 appears in SCOPe 2.07