| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
| Protein Mn superoxide dismutase (MnSOD) [46618] (9 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46619] (35 PDB entries) |
| Domain d1ztea1: 1zte A:1-83 [125641] Other proteins in same PDB: d1ztea2, d1zteb2, d1ztec2, d1zted2 automated match to d1pl4a1 complexed with mn |
PDB Entry: 1zte (more details), 1.85 Å
SCOPe Domain Sequences for d1ztea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ztea1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaahvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp
Timeline for d1ztea1: