Class a: All alpha proteins [46456] (285 folds) |
Fold a.149: RNase III domain-like [69064] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.149.1: RNase III domain-like [69065] (2 families) |
Family a.149.1.2: PF0609-like [140675] (2 proteins) specific to Thermococci; shares conserved carboxylic residues and similar dimerisation mode with the RNase III domain; contains integrated in the fold extra C-terminal helix, making it similar to the core fold of Ribosomal protein S7 (47972) automatically mapped to Pfam PF11469 |
Protein automated matches [190862] (1 species) not a true protein |
Species Pyrococcus furiosus [TaxId:2261] [188202] (1 PDB entry) automatically mapped to Pfam PF09010 |
Domain d1ztdb_: 1ztd B: [125640] Other proteins in same PDB: d1ztda1 automated match to d1ztda1 |
PDB Entry: 1ztd (more details), 2 Å
SCOPe Domain Sequences for d1ztdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ztdb_ a.149.1.2 (B:) automated matches {Pyrococcus furiosus [TaxId: 2261]} seidkglakfgdslinflyslalteflgkptgdrvpnaslaialeltglsknlrrvdkha kgdyaealiakawlmglisereaveiikknlypevldfskkkeaigralapllviiserl yssqv
Timeline for d1ztdb_: