SCOPe 2.04: Domain d1ztdb_: 1ztd B:

Lineage for d1ztdb_ (1ztd B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.149: RNase III domain-like [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III domain-like [69065] (2 families)

5. Family a.149.1.2: PF0609-like [140675] (2 proteins)
   specific to Thermococci; shares conserved carboxylic residues and similar dimerisation mode with the RNase III domain; contains integrated in the fold extra C-terminal helix, making it similar to the core fold of Ribosomal protein S7 (47972)
   automatically mapped to Pfam PF11469

6. Protein automated matches [190862] (1 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [188202] (1 PDB entry)
   automatically mapped to Pfam PF09010

8. Domain d1ztdb_: 1ztd B: [125640]
   Other proteins in same PDB: d1ztda1
   automated match to d1ztda1

Details for d1ztdb_

PDB Entry: 1ztd, 2 Å

PDB Description: hypothetical protein pfu-631545-001 from pyrococcus furiosus

PDB Compounds: (B:) Hypothetical Protein Pfu-631545-001

SCOPe Domain Sequences for d1ztdb_:

Sequence; same for both SEQRES and ATOM records:

>d1ztdb_ a.149.1.2 (B:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
seidkglakfgdslinflyslalteflgkptgdrvpnaslaialeltglsknlrrvdkha
kgdyaealiakawlmglisereaveiikknlypevldfskkkeaigralapllviiserl
yssqv

Timeline for d1ztdb_:

• d1ztdb_ first appeared in SCOP 1.73, called d1ztdb1
  
• d1ztdb_ appears in SCOPe 2.03
  
• d1ztdb_ appears in SCOPe 2.05
  
• d1ztdb_ appears in the current release, SCOPe 2.08, called d1ztdb2