Lineage for d1ztdb1 (1ztd B:2-125)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650106Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 650107Superfamily a.149.1: RNase III domain-like [69065] (2 families) (S)
  5. 650140Family a.149.1.2: PF0609-like [140675] (1 protein)
    specific to Thermococci; shares conserved carboxylic residues and similar dimerisation mode with the RNase III domain; contains integrated in the fold extra C-terminal helix, making it similar to the core fold of Ribosomal protein S7 (scop_cf 47972)
  6. 650141Protein Hypothetical protein PF0609 [140676] (1 species)
    SECSG target pfu-631545-001
  7. 650142Species Pyrococcus furiosus [TaxId:2261] [140677] (1 PDB entry)
  8. 650144Domain d1ztdb1: 1ztd B:2-125 [125640]
    automatically matched to 1ZTD A:2-125

Details for d1ztdb1

PDB Entry: 1ztd (more details), 2 Å

PDB Description: hypothetical protein pfu-631545-001 from pyrococcus furiosus
PDB Compounds: (B:) Hypothetical Protein Pfu-631545-001

SCOP Domain Sequences for d1ztdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztdb1 a.149.1.2 (B:2-125) Hypothetical protein PF0609 {Pyrococcus furiosus [TaxId: 2261]}
eidkglakfgdslinflyslalteflgkptgdrvpnaslaialeltglsknlrrvdkhak
gdyaealiakawlmglisereaveiikknlypevldfskkkeaigralapllviiserly
ssqv

SCOP Domain Coordinates for d1ztdb1:

Click to download the PDB-style file with coordinates for d1ztdb1.
(The format of our PDB-style files is described here.)

Timeline for d1ztdb1: