SCOPe 2.06: Domain d1ztcd2: 1ztc D:1-206

Lineage for d1ztcd2 (1ztc D:1-206)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.11: TM0894-like [143930] (1 protein)
   part of Pfam PF00753

6. Protein Hypothetical protein TM0894 [143931] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [143932] (1 PDB entry)
   Uniprot Q9WZZ6 1-207

8. Domain d1ztcd2: 1ztc D:1-206 [125638]
   Other proteins in same PDB: d1ztca2, d1ztcb3, d1ztcc3, d1ztcd3
   automated match to d1ztca1
   complexed with mpd, ni, po4

Details for d1ztcd2

PDB Entry: 1ztc, 2.1 Å

PDB Description: crystal structure of a putative metallo-beta-lactamase (tm0894) from thermotoga maritima at 2.10 a resolution

PDB Compounds: (D:) hypothetical protein TM0894

SCOPe Domain Sequences for d1ztcd2:

Sequence; same for both SEQRES and ATOM records:

>d1ztcd2 d.157.1.11 (D:1-206) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]}
melkilvtggnvfvpgrlnahfstvvylehkdrriiidpgnlssmdeleekfselgispd
ditdvlfthvhldhifnsvlfenatfyvhevyktknylsfgtivgriyskvisswknvvl
lkgeeslfdekvkvfhtpwharehlsflldtenagrvlitgditpnrlsyydiikgygsv
qvknfldrvgridllvfphdaplkpe

Timeline for d1ztcd2:

• d1ztcd2 first appeared in SCOP 1.73, called d1ztcd1
  
• d1ztcd2 was called d1ztcd_ in SCOPe 2.05
  
• d1ztcd2 appears in SCOPe 2.07
  
• d1ztcd2 appears in the current release, SCOPe 2.08