SCOP 1.73: Domain d1ztcc1: 1ztc C:1-205

Lineage for d1ztcc1 (1ztc C:1-205)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families)

5. Family d.157.1.11: TM0894-like [143930] (1 protein)
   part of Pfam PF00753

6. Protein Hypothetical protein TM0894 [143931] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [143932] (1 PDB entry)

8. Domain d1ztcc1: 1ztc C:1-205 [125637]
   automatically matched to 1ZTC A:1-207
   complexed with mpd, ni, po4

Details for d1ztcc1

PDB Entry: 1ztc, 2.1 Å

PDB Description: crystal structure of a putative metallo-beta-lactamase (tm0894) from thermotoga maritima at 2.10 a resolution

PDB Compounds: (C:) hypothetical protein TM0894

SCOP Domain Sequences for d1ztcc1:

Sequence; same for both SEQRES and ATOM records:

>d1ztcc1 d.157.1.11 (C:1-205) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]}
melkilvtggnvfvpgrlnahfstvvylehkdrriiidpgnlssmdeleekfselgispd
ditdvlfthvhldhifnsvlfenatfyvhevyktknylsfgtivgriyskvisswknvvl
lkgeeslfdekvkvfhtpwharehlsflldtenagrvlitgditpnrlsyydiikgygsv
qvknfldrvgridllvfphdaplkp

Timeline for d1ztcc1:

• d1ztcc1 is new in SCOP 1.73
  
• d1ztcc1 appears in SCOP 1.75
  
• d1ztcc1 appears in the current release, SCOPe 2.08, called d1ztcc2