Lineage for d1ztcc2 (1ztc C:1-205)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997254Family d.157.1.11: TM0894-like [143930] (1 protein)
    part of Pfam PF00753
  6. 2997255Protein Hypothetical protein TM0894 [143931] (1 species)
  7. 2997256Species Thermotoga maritima [TaxId:2336] [143932] (1 PDB entry)
    Uniprot Q9WZZ6 1-207
  8. 2997259Domain d1ztcc2: 1ztc C:1-205 [125637]
    Other proteins in same PDB: d1ztca2, d1ztcb3, d1ztcc3, d1ztcd3
    automated match to d1ztca1
    complexed with mpd, ni, po4

Details for d1ztcc2

PDB Entry: 1ztc (more details), 2.1 Å

PDB Description: crystal structure of a putative metallo-beta-lactamase (tm0894) from thermotoga maritima at 2.10 a resolution
PDB Compounds: (C:) hypothetical protein TM0894

SCOPe Domain Sequences for d1ztcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztcc2 d.157.1.11 (C:1-205) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]}
melkilvtggnvfvpgrlnahfstvvylehkdrriiidpgnlssmdeleekfselgispd
ditdvlfthvhldhifnsvlfenatfyvhevyktknylsfgtivgriyskvisswknvvl
lkgeeslfdekvkvfhtpwharehlsflldtenagrvlitgditpnrlsyydiikgygsv
qvknfldrvgridllvfphdaplkp

SCOPe Domain Coordinates for d1ztcc2:

Click to download the PDB-style file with coordinates for d1ztcc2.
(The format of our PDB-style files is described here.)

Timeline for d1ztcc2: