Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.11: TM0894-like [143930] (1 protein) part of Pfam PF00753 |
Protein Hypothetical protein TM0894 [143931] (1 species) |
Species Thermotoga maritima [TaxId:2336] [143932] (1 PDB entry) Uniprot Q9WZZ6 1-207 |
Domain d1ztcb_: 1ztc B: [125636] automated match to d1ztca1 complexed with mpd, ni, po4 |
PDB Entry: 1ztc (more details), 2.1 Å
SCOPe Domain Sequences for d1ztcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ztcb_ d.157.1.11 (B:) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} hhmelkilvtggnvfvpgrlnahfstvvylehkdrriiidpgnlssmdeleekfselgis pdditdvlfthvhldhifnsvlfenatfyvhevyktknylsfgtivgriyskvisswknv vllkgeeslfdekvkvfhtpwharehlsflldtenagrvlitgditpnrlsyydiikgyg svqvknfldrvgridllvfphdaplkpev
Timeline for d1ztcb_: