Lineage for d1ztcb_ (1ztc B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1937671Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1937672Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1938044Family d.157.1.11: TM0894-like [143930] (1 protein)
    part of Pfam PF00753
  6. 1938045Protein Hypothetical protein TM0894 [143931] (1 species)
  7. 1938046Species Thermotoga maritima [TaxId:2336] [143932] (1 PDB entry)
    Uniprot Q9WZZ6 1-207
  8. 1938048Domain d1ztcb_: 1ztc B: [125636]
    automated match to d1ztca1
    complexed with mpd, ni, po4

Details for d1ztcb_

PDB Entry: 1ztc (more details), 2.1 Å

PDB Description: crystal structure of a putative metallo-beta-lactamase (tm0894) from thermotoga maritima at 2.10 a resolution
PDB Compounds: (B:) hypothetical protein TM0894

SCOPe Domain Sequences for d1ztcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztcb_ d.157.1.11 (B:) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]}
hhmelkilvtggnvfvpgrlnahfstvvylehkdrriiidpgnlssmdeleekfselgis
pdditdvlfthvhldhifnsvlfenatfyvhevyktknylsfgtivgriyskvisswknv
vllkgeeslfdekvkvfhtpwharehlsflldtenagrvlitgditpnrlsyydiikgyg
svqvknfldrvgridllvfphdaplkpev

SCOPe Domain Coordinates for d1ztcb_:

Click to download the PDB-style file with coordinates for d1ztcb_.
(The format of our PDB-style files is described here.)

Timeline for d1ztcb_: