Lineage for d1zt9b_ (1zt9 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695732Superfamily a.4.12: TrpR-like [48295] (4 families) (S)
    contains an extra shared helix after the HTH motif
  5. 2695733Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
    intertwined dimer of identical 6-helical subunits
    automatically mapped to Pfam PF01371
  6. 2695734Protein Trp repressor, TrpR [48297] (1 species)
  7. 2695735Species Escherichia coli [TaxId:562] [48298] (19 PDB entries)
  8. 2695757Domain d1zt9b_: 1zt9 B: [125632]
    automated match to d1co0a_
    complexed with so4, trp

Details for d1zt9b_

PDB Entry: 1zt9 (more details), 2 Å

PDB Description: e. coli trp repressor, tetragonal crystal form
PDB Compounds: (B:) trp operon repressor

SCOPe Domain Sequences for d1zt9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zt9b_ a.4.12.1 (B:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]}
spysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellrg
emsqrelknelgagiatitrgsnslkaapvelrqwleevll

SCOPe Domain Coordinates for d1zt9b_:

Click to download the PDB-style file with coordinates for d1zt9b_.
(The format of our PDB-style files is described here.)

Timeline for d1zt9b_: