SCOPe 2.08: Domain d1zt9a_: 1zt9 A:

Lineage for d1zt9a_ (1zt9 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.12: TrpR-like [48295] (4 families)
   contains an extra shared helix after the HTH motif

5. Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
   intertwined dimer of identical 6-helical subunits
   automatically mapped to Pfam PF01371

6. Protein Trp repressor, TrpR [48297] (1 species)

7. Species Escherichia coli [TaxId:562] [48298] (19 PDB entries)

8. Domain d1zt9a_: 1zt9 A: [125631]
   automated match to d1co0a_
   complexed with so4, trp

Details for d1zt9a_

PDB Entry: 1zt9, 2 Å

PDB Description: e. coli trp repressor, tetragonal crystal form

PDB Compounds: (A:) trp operon repressor

SCOPe Domain Sequences for d1zt9a_:

Sequence; same for both SEQRES and ATOM records:

>d1zt9a_ a.4.12.1 (A:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]}
spysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellrg
emsqrelknelgagiatitrgsnslkaapvelrqwleevll

Timeline for d1zt9a_:

• d1zt9a_ first appeared in SCOP 1.73, called d1zt9a1
  
• d1zt9a_ appears in SCOPe 2.07