Lineage for d1zt7d1 (1zt7 D:1-99)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654119Protein beta2-microglobulin [88600] (4 species)
  7. 654353Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries)
  8. 654477Domain d1zt7d1: 1zt7 D:1-99 [125630]
    automatically matched to d1bz9b_

Details for d1zt7d1

PDB Entry: 1zt7 (more details), 3 Å

PDB Description: crystal structure of class I MHC H-2Kk in complex with a nonapeptide
PDB Compounds: (D:) Beta-2-microglobulin

SCOP Domain Sequences for d1zt7d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zt7d1 b.1.1.2 (D:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1zt7d1:

Click to download the PDB-style file with coordinates for d1zt7d1.
(The format of our PDB-style files is described here.)

Timeline for d1zt7d1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zt7b1