SCOP 1.73: Domain d1zt2b1: 1zt2 B:3-209

Lineage for d1zt2b1 (1zt2 B:3-209)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.262: PriB N-terminal domain-like [140913] (1 superfamily)
   multihelical bundle; contains buried central helix; also includes the PriA interface-forming insert subdomain (alpha+beta)

4. Superfamily a.262.1: PriB N-terminal domain-like [140914] (1 family)

5. Family a.262.1.1: PriB N-terminal domain-like [140915] (1 protein)

6. Protein DNA primase large subunit PriB, N-terminal domain [140916] (1 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [140917] (1 PDB entry)

8. Domain d1zt2b1: 1zt2 B:3-209 [125625]
   Other proteins in same PDB: d1zt2a1
   complexed with so4, zn

Details for d1zt2b1

PDB Entry: 1zt2, 3.33 Å

PDB Description: Heterodimeric structure of the core primase.

PDB Compounds: (B:) DNA primase large subunit

SCOP Domain Sequences for d1zt2b1:

Sequence; same for both SEQRES and ATOM records:

>d1zt2b1 a.262.1.1 (B:3-209) DNA primase large subunit PriB, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
ldvkkypfikslddelkkygggitltdlllnsttlidqakdriqktksgdelphyvsyne
pvlvfyttllslailndvklirryayaeakqfrsllhteneenlleisklldlkinrcdp
ikfylekkrriiqkefcvhfidylkytkdlkedwklsgqilhkgyvyldknqligliaes
ikskivemirplnlkeipeklkslier

Timeline for d1zt2b1:

• d1zt2b1 is new in SCOP 1.73
  
• d1zt2b1 appears in SCOP 1.75
  
• d1zt2b1 appears in the current release, SCOPe 2.08