Lineage for d1zt2a1 (1zt2 A:3-329)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 881655Fold d.264: Prim-pol domain [56746] (1 superfamily)
    consists of two alpha+beta domains
  4. 881656Superfamily d.264.1: Prim-pol domain [56747] (3 families) (S)
  5. 881657Family d.264.1.1: PriA-like [56748] (2 proteins)
    contains additional insert all-alpha subdomain
  6. 881665Protein DNA primase small subunit PriA [143895] (1 species)
    includes insert zinc-finger domain and extra C-terminal alpha+beta subdomain
  7. 881666Species Sulfolobus solfataricus [TaxId:2287] [143896] (1 PDB entry)
    Uniprot Q97Z83 3-329
  8. 881667Domain d1zt2a1: 1zt2 A:3-329 [125624]
    Other proteins in same PDB: d1zt2b1, d1zt2d1
    complexed with so4, zn

Details for d1zt2a1

PDB Entry: 1zt2 (more details), 3.33 Å

PDB Description: Heterodimeric structure of the core primase.
PDB Compounds: (A:) DNA primase small subunit

SCOP Domain Sequences for d1zt2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zt2a1 d.264.1.1 (A:3-329) DNA primase small subunit PriA {Sulfolobus solfataricus [TaxId: 2287]}
tftlhqgqtnliksffrnyylnaelelpkdmelrefalqpfgsdtyvrhlsfssseelrd
ylvnrnlplhlfyssaryqlpsarnmeekawmgsdllfdidadhlcklrsirfcpvcgna
vvsekcerdnvetleyvemtsecikrgleqtrnlveileddfglkpkvyfsgnrgfhvqv
dcygncalldsderkeiaeyvmgigvpgypggsenapgwvgrknrgingvtideqvtidv
krliripnslhgksglivkrvpnlddfefnetlspftgytiflpyitietevlgsiikln
rgipikikssigiylhlrnlgevkayv

SCOP Domain Coordinates for d1zt2a1:

Click to download the PDB-style file with coordinates for d1zt2a1.
(The format of our PDB-style files is described here.)

Timeline for d1zt2a1: