SCOPe 2.08: Domain d1zt1b_: 1zt1 B:

Lineage for d1zt1b_ (1zt1 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
   Uniprot P01887

8. Domain d1zt1b_: 1zt1 B: [125623]
   Other proteins in same PDB: d1zt1a1, d1zt1a2
   automated match to d1bz9b_
   complexed with cl

Details for d1zt1b_

PDB Entry: 1zt1, 2.5 Å

PDB Description: crystal structure of class i mhc h-2kk in complex with an octapeptide

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1zt1b_:

Sequence; same for both SEQRES and ATOM records:

>d1zt1b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
fyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1zt1b_:

• d1zt1b_ first appeared in SCOP 1.73, called d1zt1b1
  
• d1zt1b_ appears in SCOPe 2.07