SCOPe 2.06: Domain d1zsza1: 1zsz A:5-110

Lineage for d1zsza1 (1zsz A:5-110)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.136: SspB-like [101737] (1 superfamily)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold

4. Superfamily b.136.1: SspB-like [101738] (3 families)

5. Family b.136.1.1: Stringent starvation protein B, SspB [101739] (2 proteins)
   automatically mapped to Pfam PF04386

6. Protein Stringent starvation protein B, SspB [101740] (2 species)
   a specificity-enhancing factor for the ClpXP proteolytic machine

7. Species Haemophilus influenzae [TaxId:727] [101742] (5 PDB entries)
   Uniprot P45206 5-110

8. Domain d1zsza1: 1zsz A:5-110 [125622]
   automatically matched to d1oula_
   complexed with mg

Details for d1zsza1

PDB Entry: 1zsz, 2 Å

PDB Description: crystal structure of a computationally designed sspb heterodimer

PDB Compounds: (A:) Stringent starvation protein B homolog

SCOPe Domain Sequences for d1zsza1:

Sequence; same for both SEQRES and ATOM records:

>d1zsza1 b.136.1.1 (A:5-110) Stringent starvation protein B, SspB {Haemophilus influenzae [TaxId: 727]}
sspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatgnlql
tndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiyd

Timeline for d1zsza1:

• d1zsza1 first appeared in SCOP 1.73
  
• d1zsza1 appears in SCOPe 2.05
  
• d1zsza1 appears in SCOPe 2.07
  
• d1zsza1 appears in the current release, SCOPe 2.08