Lineage for d1zsza1 (1zsz A:5-110)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813565Fold b.136: SspB-like [101737] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 813566Superfamily b.136.1: SspB-like [101738] (2 families) (S)
  5. 813567Family b.136.1.1: Stringent starvation protein B, SspB [101739] (1 protein)
  6. 813568Protein Stringent starvation protein B, SspB [101740] (2 species)
    a specificity-enhancing factor for the ClpXP proteolytic machine
  7. 813584Species Haemophilus influenzae [TaxId:727] [101742] (5 PDB entries)
    Uniprot P45206 5-110
  8. 813592Domain d1zsza1: 1zsz A:5-110 [125622]
    automatically matched to d1oula_
    complexed with mg; mutant

Details for d1zsza1

PDB Entry: 1zsz (more details), 2 Å

PDB Description: crystal structure of a computationally designed sspb heterodimer
PDB Compounds: (A:) Stringent starvation protein B homolog

SCOP Domain Sequences for d1zsza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zsza1 b.136.1.1 (A:5-110) Stringent starvation protein B, SspB {Haemophilus influenzae [TaxId: 727]}
sspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatgnlql
tndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiyd

SCOP Domain Coordinates for d1zsza1:

Click to download the PDB-style file with coordinates for d1zsza1.
(The format of our PDB-style files is described here.)

Timeline for d1zsza1: