Lineage for d1zswa2 (1zsw A:145-314)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942874Family d.32.1.10: BC1024-like [143129] (1 protein)
    duplication: consists of 2 similar domains with 2 repeats in each; similar to the glyoxalase dimer
  6. 2942875Protein Hypothetical protein BC1024 [143130] (1 species)
  7. 2942876Species Bacillus cereus [TaxId:1396] [143131] (1 PDB entry)
    Uniprot Q81H03 1-144! Uniprot Q81H03 145-314
  8. 2942878Domain d1zswa2: 1zsw A:145-314 [125621]
    Other proteins in same PDB: d1zswa3
    complexed with bme, zn

Details for d1zswa2

PDB Entry: 1zsw (more details), 1.65 Å

PDB Description: Crystal Structure of Bacillus cereus Metallo Protein from Glyoxalase family
PDB Compounds: (A:) Glyoxalase family protein

SCOPe Domain Sequences for d1zswa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]}
ksevpakhqiqgmgsveltvrrldkmastlteifgytevsrndqeaifqsikgeafgeiv
vkyldgptekpgrgsihhlairvkndaelayweeqvkqrgfhssgiidrfyfkslyfres
ngilfeiatdgpgftvdgdvehlgekldlppfledqraeieanlapieek

SCOPe Domain Coordinates for d1zswa2:

Click to download the PDB-style file with coordinates for d1zswa2.
(The format of our PDB-style files is described here.)

Timeline for d1zswa2: