SCOPe 2.05: Domain d1zswa1: 1zsw A:1-144

Lineage for d1zswa1 (1zsw A:1-144)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.10: BC1024-like [143129] (1 protein)
   duplication: consists of 2 similar domains with 2 repeats in each; similar to the glyoxalase dimer

6. Protein Hypothetical protein BC1024 [143130] (1 species)

7. Species Bacillus cereus [TaxId:1396] [143131] (1 PDB entry)
   Uniprot Q81H03 1-144! Uniprot Q81H03 145-314

8. Domain d1zswa1: 1zsw A:1-144 [125620]
   complexed with bme, zn

Details for d1zswa1

PDB Entry: 1zsw, 1.65 Å

PDB Description: Crystal Structure of Bacillus cereus Metallo Protein from Glyoxalase family

PDB Compounds: (A:) Glyoxalase family protein

SCOPe Domain Sequences for d1zswa1:

Sequence; same for both SEQRES and ATOM records:

>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]}
myeikghhhismvtknanennhfyknvlglrrvkmtvnqddpsmyhlfygdktgspgtel
sffeiplvgrtyrgtnaitrigllvpsedslhywkerfekfdvkhsemttyanrpalqfe
daeglrlvllvsngekvehwetwe

Timeline for d1zswa1:

• d1zswa1 first appeared in SCOP 1.73
  
• d1zswa1 appears in SCOPe 2.04
  
• d1zswa1 appears in SCOPe 2.06
  
• d1zswa1 appears in the current release, SCOPe 2.08