![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.10: BC1024-like [143129] (1 protein) duplication: consists of 2 similar domains with 2 repeats in each; similar to the glyoxalase dimer |
![]() | Protein Hypothetical protein BC1024 [143130] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [143131] (1 PDB entry) Uniprot Q81H03 1-144! Uniprot Q81H03 145-314 |
![]() | Domain d1zswa1: 1zsw A:1-144 [125620] Other proteins in same PDB: d1zswa3 complexed with bme, zn |
PDB Entry: 1zsw (more details), 1.65 Å
SCOPe Domain Sequences for d1zswa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} myeikghhhismvtknanennhfyknvlglrrvkmtvnqddpsmyhlfygdktgspgtel sffeiplvgrtyrgtnaitrigllvpsedslhywkerfekfdvkhsemttyanrpalqfe daeglrlvllvsngekvehwetwe
Timeline for d1zswa1: