Lineage for d1zsqa2 (1zsq A:199-585)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875702Family c.45.1.3: Myotubularin-like phosphatases [102422] (2 proteins)
    common fold is decorated with additional structures
  6. 2875703Protein Myotubularin-related protein 2, C-terminal domain [102423] (1 species)
  7. 2875704Species Human (Homo sapiens) [TaxId:9606] [102424] (5 PDB entries)
  8. 2875705Domain d1zsqa2: 1zsq A:199-585 [125617]
    Other proteins in same PDB: d1zsqa1
    automated match to d1lw3a2
    complexed with edo, pib

Details for d1zsqa2

PDB Entry: 1zsq (more details), 1.82 Å

PDB Description: crystal structure of mtmr2 in complex with phosphatidylinositol 3- phosphate
PDB Compounds: (A:) Myotubularin-related protein 2

SCOPe Domain Sequences for d1zsqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
evfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipdeelkrv
asfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaqshkifi
fdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivypnieeth
wlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslamlmldgy
yrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrqfptaf
efneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftnplygs
ysnhvlypvasmrhlelwvgyyirwnp

SCOPe Domain Coordinates for d1zsqa2:

Click to download the PDB-style file with coordinates for d1zsqa2.
(The format of our PDB-style files is described here.)

Timeline for d1zsqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zsqa1