SCOPe 2.07: Domain d1zsqa1: 1zsq A:73-198

Lineage for d1zsqa1 (1zsq A:73-198)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.8: GRAM domain [101839] (1 protein)

6. Protein Myotubularin-related protein 2, N-terminal domain [101840] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101841] (5 PDB entries)

8. Domain d1zsqa1: 1zsq A:73-198 [125616]
   Other proteins in same PDB: d1zsqa2
   automated match to d1zsqa1
   complexed with edo, pib

Details for d1zsqa1

PDB Entry: 1zsq, 1.82 Å

PDB Description: crystal structure of mtmr2 in complex with phosphatidylinositol 3- phosphate

PDB Compounds: (A:) Myotubularin-related protein 2

SCOPe Domain Sequences for d1zsqa1:

Sequence; same for both SEQRES and ATOM records:

>d1zsqa1 b.55.1.8 (A:73-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
meeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvi
nrvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlpl
fafeyk

Timeline for d1zsqa1:

• d1zsqa1 first appeared in SCOP 1.73
  
• d1zsqa1 appears in SCOPe 2.06
  
• d1zsqa1 appears in the current release, SCOPe 2.08