SCOP 1.73: Domain d1zsqa1: 1zsq A:74-198

Lineage for d1zsqa1 (1zsq A:74-198)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (12 families)

5. Family b.55.1.8: GRAM domain [101839] (1 protein)

6. Protein Myotubularin-related protein 2, N-terminal domain [101840] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101841] (4 PDB entries)

8. Domain d1zsqa1: 1zsq A:74-198 [125616]
   Other proteins in same PDB: d1zsqa2
   automatically matched to d1lw3a1
   complexed with edo, pib; mutant

Details for d1zsqa1

PDB Entry: 1zsq, 1.82 Å

PDB Description: crystal structure of mtmr2 in complex with phosphatidylinositol 3- phosphate

PDB Compounds: (A:) Myotubularin-related protein 2

SCOP Domain Sequences for d1zsqa1:

Sequence; same for both SEQRES and ATOM records:

>d1zsqa1 b.55.1.8 (A:74-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
eeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvin
rvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplf
afeyk

Timeline for d1zsqa1:

• d1zsqa1 is new in SCOP 1.73
  
• d1zsqa1 appears in SCOP 1.75
  
• d1zsqa1 appears in the current release, SCOPe 2.08