![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.8: GRAM domain [101839] (1 protein) |
![]() | Protein Myotubularin-related protein 2, N-terminal domain [101840] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101841] (5 PDB entries) |
![]() | Domain d1zsqa1: 1zsq A:73-198 [125616] Other proteins in same PDB: d1zsqa2 automated match to d1zsqa1 complexed with edo, pib |
PDB Entry: 1zsq (more details), 1.82 Å
SCOPe Domain Sequences for d1zsqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zsqa1 b.55.1.8 (A:73-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} meeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvi nrvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlpl fafeyk
Timeline for d1zsqa1: