Lineage for d1zspb2 (1zsp B:84-198)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513720Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2513721Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2513722Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 protein domains)
  6. 2513848Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2513912Species Human (Homo sapiens) [TaxId:9606] [54724] (31 PDB entries)
  8. 2513934Domain d1zspb2: 1zsp B:84-198 [125615]
    Other proteins in same PDB: d1zspa1, d1zspb1
    automated match to d2p4ka2
    complexed with mn

Details for d1zspb2

PDB Entry: 1zsp (more details), 1.9 Å

PDB Description: Contribution to Structure and Catalysis of Tyrosine 34 in Human Manganese Superoxide Dismutase
PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d1zspb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zspb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOPe Domain Coordinates for d1zspb2:

Click to download the PDB-style file with coordinates for d1zspb2.
(The format of our PDB-style files is described here.)

Timeline for d1zspb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zspb1