SCOP 1.75: Domain d1zspa1: 1zsp A:1-83

Lineage for d1zspa1 (1zsp A:1-83)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46619] (27 PDB entries)

8. Domain d1zspa1: 1zsp A:1-83 [125612]
   Other proteins in same PDB: d1zspa2, d1zspb2
   automatically matched to d1ap5a1
   complexed with mn; mutant

Details for d1zspa1

PDB Entry: 1zsp, 1.9 Å

PDB Description: contribution to structure and catalysis of tyrosine 34 in human manganese superoxide dismutase

PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOP Domain Sequences for d1zspa1:

Sequence; same for both SEQRES and ATOM records:

>d1zspa1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaaavnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

Timeline for d1zspa1:

• d1zspa1 first appeared in SCOP 1.73
  
• d1zspa1 appears in SCOPe 2.01
  
• d1zspa1 appears in the current release, SCOPe 2.08