SCOPe 2.07: Domain d1zsob2: 1zso B:1-156

Lineage for d1zsob2 (1zso B:1-156)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.166: MAL13P1.257-like [141677] (1 superfamily)
   complex fold; duplication: consists of two intertwinned structural repeats related by pseudo dyad

4. Superfamily b.166.1: MAL13P1.257-like [141678] (2 families)
   automatically mapped to Pfam PF05907

5. Family b.166.1.1: MAL13P1.257-like [141679] (1 protein)
   PANTHER 12857; DUF866_euk

6. Protein Hypothetical protein MAL13P1.257 [141680] (1 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141681] (1 PDB entry)
   Uniprot Q8IDI8 1-156

8. Domain d1zsob2: 1zso B:1-156 [125611]
   Other proteins in same PDB: d1zsob3
   automated match to d1zsoa1

Details for d1zsob2

PDB Entry: 1zso, 2.17 Å

PDB Description: hypothetical protein from plasmodium falciparum

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d1zsob2:

Sequence; same for both SEQRES and ATOM records:

>d1zsob2 b.166.1.1 (B:1-156) Hypothetical protein MAL13P1.257 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mkntvvrikaelenvkrlfcddeylwifnirdstssltrdniqfrktdileipnsrgtan
fmikwteypkystinfvntknscsyeevnnnewrdfasfecrgielidffpsnnfivedt
kgklyydvnlsdqnwcdyneehemcvgiynleyevn

Timeline for d1zsob2:

• d1zsob2 first appeared in SCOP 1.73, called d1zsob1
  
• d1zsob2 appears in SCOPe 2.06
  
• d1zsob2 appears in the current release, SCOPe 2.08