Lineage for d1zsob2 (1zso B:1-156)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825531Fold b.166: MAL13P1.257-like [141677] (1 superfamily)
    complex fold; duplication: consists of two intertwinned structural repeats related by pseudo dyad
  4. 2825532Superfamily b.166.1: MAL13P1.257-like [141678] (2 families) (S)
    automatically mapped to Pfam PF05907
  5. 2825533Family b.166.1.1: MAL13P1.257-like [141679] (1 protein)
    PANTHER 12857; DUF866_euk
  6. 2825534Protein Hypothetical protein MAL13P1.257 [141680] (1 species)
  7. 2825535Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141681] (1 PDB entry)
    Uniprot Q8IDI8 1-156
  8. 2825537Domain d1zsob2: 1zso B:1-156 [125611]
    Other proteins in same PDB: d1zsob3
    automated match to d1zsoa1

Details for d1zsob2

PDB Entry: 1zso (more details), 2.17 Å

PDB Description: hypothetical protein from plasmodium falciparum
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d1zsob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zsob2 b.166.1.1 (B:1-156) Hypothetical protein MAL13P1.257 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mkntvvrikaelenvkrlfcddeylwifnirdstssltrdniqfrktdileipnsrgtan
fmikwteypkystinfvntknscsyeevnnnewrdfasfecrgielidffpsnnfivedt
kgklyydvnlsdqnwcdyneehemcvgiynleyevn

SCOPe Domain Coordinates for d1zsob2:

Click to download the PDB-style file with coordinates for d1zsob2.
(The format of our PDB-style files is described here.)

Timeline for d1zsob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zsob3
View in 3D
Domains from other chains:
(mouse over for more information)
d1zsoa1