Class b: All beta proteins [48724] (177 folds) |
Fold b.166: MAL13P1.257-like [141677] (1 superfamily) complex fold; duplication: consists of two intertwinned structural repeats related by pseudo dyad |
Superfamily b.166.1: MAL13P1.257-like [141678] (1 family) automatically mapped to Pfam PF05907 |
Family b.166.1.1: MAL13P1.257-like [141679] (1 protein) PANTHER 12857; DUF866_euk |
Protein Hypothetical protein MAL13P1.257 [141680] (1 species) |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141681] (1 PDB entry) Uniprot Q8IDI8 1-156 |
Domain d1zsoa1: 1zso A:1-156 [125610] Other proteins in same PDB: d1zsob3 |
PDB Entry: 1zso (more details), 2.17 Å
SCOPe Domain Sequences for d1zsoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zsoa1 b.166.1.1 (A:1-156) Hypothetical protein MAL13P1.257 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} mkntvvrikaelenvkrlfcddeylwifnirdstssltrdniqfrktdileipnsrgtan fmikwteypkystinfvntknscsyeevnnnewrdfasfecrgielidffpsnnfivedt kgklyydvnlsdqnwcdyneehemcvgiynleyevn
Timeline for d1zsoa1: