SCOPe 2.06: Domain d1zsoa1: 1zso A:1-156

Lineage for d1zsoa1 (1zso A:1-156)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.166: MAL13P1.257-like [141677] (1 superfamily)
   complex fold; duplication: consists of two intertwinned structural repeats related by pseudo dyad

4. Superfamily b.166.1: MAL13P1.257-like [141678] (1 family)
   automatically mapped to Pfam PF05907

5. Family b.166.1.1: MAL13P1.257-like [141679] (1 protein)
   PANTHER 12857; DUF866_euk

6. Protein Hypothetical protein MAL13P1.257 [141680] (1 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141681] (1 PDB entry)
   Uniprot Q8IDI8 1-156

8. Domain d1zsoa1: 1zso A:1-156 [125610]
   Other proteins in same PDB: d1zsob3

Details for d1zsoa1

PDB Entry: 1zso, 2.17 Å

PDB Description: hypothetical protein from plasmodium falciparum

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1zsoa1:

Sequence; same for both SEQRES and ATOM records:

>d1zsoa1 b.166.1.1 (A:1-156) Hypothetical protein MAL13P1.257 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mkntvvrikaelenvkrlfcddeylwifnirdstssltrdniqfrktdileipnsrgtan
fmikwteypkystinfvntknscsyeevnnnewrdfasfecrgielidffpsnnfivedt
kgklyydvnlsdqnwcdyneehemcvgiynleyevn

Timeline for d1zsoa1:

• d1zsoa1 first appeared in SCOP 1.73
  
• d1zsoa1 appears in SCOPe 2.05
  
• d1zsoa1 appears in SCOPe 2.07
  
• d1zsoa1 appears in the current release, SCOPe 2.08