SCOPe 2.07: Domain d1zsha2: 1zsh A:176-397

Lineage for d1zsha2 (1zsh A:176-397)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins)

6. Protein Arrestin [49244] (3 species)
   duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head

7. Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (6 PDB entries)

8. Domain d1zsha2: 1zsh A:176-397 [125607]
   automated match to d1jsya2
   complexed with ihp, mg

Details for d1zsha2

PDB Entry: 1zsh, 2.9 Å

PDB Description: crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (ip6)

PDB Compounds: (A:) beta-arrestin 1

SCOPe Domain Sequences for d1zsha2:

Sequence, based on SEQRES records:

>d1zsha2 b.1.18.11 (A:176-397) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpk
pkeepphrevpehetpvdtnlieldtndddivfedfarqrlk

Sequence, based on observed residues (ATOM records):

>d1zsha2 b.1.18.11 (A:176-397) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsssdvavelpftlmhpkdivfedfar
qrlk

Timeline for d1zsha2:

• d1zsha2 first appeared in SCOP 1.73
  
• d1zsha2 appears in SCOPe 2.06
  
• d1zsha2 appears in the current release, SCOPe 2.08