Lineage for d1zsha2 (1zsh A:176-397)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2032796Family b.1.18.11: Arrestin/Vps26-like [81291] (2 protein domains)
  6. 2032797Protein Arrestin [49244] (3 species)
    duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
  7. 2032798Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (6 PDB entries)
  8. 2032812Domain d1zsha2: 1zsh A:176-397 [125607]
    automated match to d1jsya2
    complexed with ihp, mg

Details for d1zsha2

PDB Entry: 1zsh (more details), 2.9 Å

PDB Description: Crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (IP6)
PDB Compounds: (A:) beta-arrestin 1

SCOPe Domain Sequences for d1zsha2:

Sequence, based on SEQRES records: (download)

>d1zsha2 b.1.18.11 (A:176-397) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpk
pkeepphrevpehetpvdtnlieldtndddivfedfarqrlk

Sequence, based on observed residues (ATOM records): (download)

>d1zsha2 b.1.18.11 (A:176-397) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsssdvavelpftlmhpkdivfedfar
qrlk

SCOPe Domain Coordinates for d1zsha2:

Click to download the PDB-style file with coordinates for d1zsha2.
(The format of our PDB-style files is described here.)

Timeline for d1zsha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zsha1