Lineage for d1zsha1 (1zsh A:6-175)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1112207Family b.1.18.11: Arrestin/Vps26-like [81291] (1 protein)
  6. 1112208Protein Arrestin [49244] (2 species)
    duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
  7. 1112209Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (4 PDB entries)
  8. 1112218Domain d1zsha1: 1zsh A:6-175 [125606]
    automatically matched to d1g4ma1
    complexed with ihp, mg

Details for d1zsha1

PDB Entry: 1zsh (more details), 2.9 Å

PDB Description: crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (ip6)
PDB Compounds: (A:) beta-arrestin 1

SCOPe Domain Sequences for d1zsha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zsha1 b.1.18.11 (A:6-175) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
trvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafrygr
edldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlpc
svtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap

SCOPe Domain Coordinates for d1zsha1:

Click to download the PDB-style file with coordinates for d1zsha1.
(The format of our PDB-style files is described here.)

Timeline for d1zsha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zsha2