Lineage for d1zs9a1 (1zs9 A:4-256)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2149266Family c.108.1.22: Enolase-phosphatase E1 [142186] (3 protein domains)
    the insertion subdomain is a 4-helical bundle
  6. 2149267Protein E-1 enzyme [142189] (1 species)
  7. 2149268Species Human (Homo sapiens) [TaxId:9606] [142190] (1 PDB entry)
    Uniprot Q9UHY7 4-256
  8. 2149269Domain d1zs9a1: 1zs9 A:4-256 [125600]
    complexed with mg

Details for d1zs9a1

PDB Entry: 1zs9 (more details), 1.7 Å

PDB Description: Crystal structure of human enolase-phosphatase E1
PDB Compounds: (A:) E-1 enzyme

SCOPe Domain Sequences for d1zs9a1:

Sequence, based on SEQRES records: (download)

>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human (Homo sapiens) [TaxId: 9606]}
lsvpaevtvilldiegtttpiafvkdilfpyieenvkeylqthweeeecqqdvsllrkqa
eedahldgavpipaasgngvddlqqmiqavvdnvcwqmsldrkttalkqlqghmwraaft
agrmkaeffadvvpavrkwreagmkvyiyssgsveaqkllfghstegdilelvdghfdtk
ighkvesesyrkiadsigcstnnilfltdvtreasaaeeadvhvavvvrpgnagltddek
tyyslitsfsely

Sequence, based on observed residues (ATOM records): (download)

>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human (Homo sapiens) [TaxId: 9606]}
lsvpaevtvilldiegtttpiafvkdilfpyieenvkeylqthweeeecqqdvsllrkqa
eedahldgavpipaasgngvddlqqmiqavvdnvcwqmsldkttalkqlqghmwraafta
grmkaeffadvvpavrkwreagmkvyiyssgsveaqkllfghstegdilelvdghfdtki
ghkvesesyrkiadsigcstnnilfltdvtreasaaeeadvhvavvvrpgnagltddekt
yyslitsfsely

SCOPe Domain Coordinates for d1zs9a1:

Click to download the PDB-style file with coordinates for d1zs9a1.
(The format of our PDB-style files is described here.)

Timeline for d1zs9a1: