SCOPe 2.02: Domain d1zs7a2: 1zs7 A:1-90

Lineage for d1zs7a2 (1zs7 A:1-90)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.6: Pre-PUA domain [88802] (5 families)
   this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins

5. Family d.17.6.4: Hypothetical protein APE0525, N-terminal domain [143004] (1 protein)

6. Protein Hypothetical protein APE0525, N-terminal domain [143005] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [143006] (3 PDB entries)
   Uniprot Q9YEQ6 1-90

8. Domain d1zs7a2: 1zs7 A:1-90 [125594]
   Other proteins in same PDB: d1zs7a1
   complexed with k, po4

Details for d1zs7a2

PDB Entry: 1zs7, 1.85 Å

PDB Description: The structure of gene product APE0525 from Aeropyrum pernix

PDB Compounds: (A:) hypothetical protein APE0525

SCOPe Domain Sequences for d1zs7a2:

Sequence; same for both SEQRES and ATOM records:

>d1zs7a2 d.17.6.4 (A:1-90) Hypothetical protein APE0525, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}
mlwarlvglarlearalskkerrsllerlkpyytripfsekadlrlvkartdsgeyeiit
vdgvpclfewsdgriyptlqclkafgvdwl

Timeline for d1zs7a2:

• d1zs7a2 first appeared in SCOP 1.73
  
• d1zs7a2 appears in SCOPe 2.01
  
• d1zs7a2 appears in SCOPe 2.03
  
• d1zs7a2 appears in the current release, SCOPe 2.08