Lineage for d1zs7a1 (1zs7 A:91-186)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680324Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 680325Superfamily b.122.1: PUA domain-like [88697] (10 families) (S)
  5. 680326Family b.122.1.1: PUA domain [88698] (5 proteins)
    RNA-binding domain
  6. 680337Protein Hypothetical protein APE0525, C-terminal domain [141700] (1 species)
  7. 680338Species Archaeon Aeropyrum pernix [TaxId:56636] [141701] (3 PDB entries)
  8. 680340Domain d1zs7a1: 1zs7 A:91-186 [125593]
    Other proteins in same PDB: d1zs7a2
    complexed with k, po4

Details for d1zs7a1

PDB Entry: 1zs7 (more details), 1.85 Å

PDB Description: The structure of gene product APE0525 from Aeropyrum pernix
PDB Compounds: (A:) hypothetical protein APE0525

SCOP Domain Sequences for d1zs7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zs7a1 b.122.1.1 (A:91-186) Hypothetical protein APE0525, C-terminal domain {Archaeon Aeropyrum pernix [TaxId: 56636]}
kgvvlvdkgaaialakgahlmipgvvgvegsftrgdvvaalyhetrtpvmvgvaevdssa
leklyrekargravrrvhrlgdalwelaqevgkrls

SCOP Domain Coordinates for d1zs7a1:

Click to download the PDB-style file with coordinates for d1zs7a1.
(The format of our PDB-style files is described here.)

Timeline for d1zs7a1:

Domains from same chain:
(mouse over for more information)
d1zs7a2