Lineage for d1zs7a1 (1zs7 A:91-186)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2823866Family b.122.1.1: PUA domain [88698] (6 proteins)
    RNA-binding domain
  6. 2823877Protein Hypothetical protein APE0525, C-terminal domain [141700] (1 species)
  7. 2823878Species Aeropyrum pernix [TaxId:56636] [141701] (3 PDB entries)
    Uniprot Q9YEQ6 91-186
  8. 2823881Domain d1zs7a1: 1zs7 A:91-186 [125593]
    Other proteins in same PDB: d1zs7a2, d1zs7a3
    complexed with k, po4

Details for d1zs7a1

PDB Entry: 1zs7 (more details), 1.85 Å

PDB Description: The structure of gene product APE0525 from Aeropyrum pernix
PDB Compounds: (A:) hypothetical protein APE0525

SCOPe Domain Sequences for d1zs7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zs7a1 b.122.1.1 (A:91-186) Hypothetical protein APE0525, C-terminal domain {Aeropyrum pernix [TaxId: 56636]}
kgvvlvdkgaaialakgahlmipgvvgvegsftrgdvvaalyhetrtpvmvgvaevdssa
leklyrekargravrrvhrlgdalwelaqevgkrls

SCOPe Domain Coordinates for d1zs7a1:

Click to download the PDB-style file with coordinates for d1zs7a1.
(The format of our PDB-style files is described here.)

Timeline for d1zs7a1: