SCOPe 2.07: Domain d1zs6d_: 1zs6 D:

Lineage for d1zs6d_ (1zs6 D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Human (Homo sapiens), NDK3 [TaxId:9606] [143283] (1 PDB entry)
   Uniprot Q13232 18-169

8. Domain d1zs6d_: 1zs6 D: [125592]
   automated match to d1zs6a1
   complexed with adp

Details for d1zs6d_

PDB Entry: 1zs6, 2.3 Å

PDB Description: structure of human nucleoside-diphosphate kinase 3

PDB Compounds: (D:) Nucleoside diphosphate kinase 3

SCOPe Domain Sequences for d1zs6d_:

Sequence; same for both SEQRES and ATOM records:

>d1zs6d_ d.58.6.1 (D:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK3 [TaxId: 9606]}
tgahertflavkpdgvqrrlvgeivrrferkgfklvalklvqaseellrehyaelrerpf
ygrlvkymasgpvvamvwqgldvvrtsraligatnpadappgtirgdfcievgknlihgs
dsvesarreialwfradellcwedsaghwlye

Timeline for d1zs6d_:

• d1zs6d_ first appeared in SCOP 1.73, called d1zs6d1
  
• d1zs6d_ appears in SCOPe 2.06
  
• d1zs6d_ appears in the current release, SCOPe 2.08