Lineage for d1zs5a2 (1zs5 A:719-832)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2319939Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2320004Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)
  7. 2320005Species Human (Homo sapiens) [TaxId:9606] [47376] (8 PDB entries)
  8. 2320009Domain d1zs5a2: 1zs5 A:719-832 [125589]
    Other proteins in same PDB: d1zs5a3
    automated match to d1zs5a1
    complexed with mib

Details for d1zs5a2

PDB Entry: 1zs5 (more details)

PDB Description: structure-based evaluation of selective and non-selective small molecules that block hiv-1 tat and pcaf association
PDB Compounds: (A:) Histone acetyltransferase PCAF

SCOPe Domain Sequences for d1zs5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zs5a2 a.29.2.1 (A:719-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
skeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlk
nryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk

SCOPe Domain Coordinates for d1zs5a2:

Click to download the PDB-style file with coordinates for d1zs5a2.
(The format of our PDB-style files is described here.)

Timeline for d1zs5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zs5a3