![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.1: Bromodomain [47371] (6 proteins) |
![]() | Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47376] (8 PDB entries) |
![]() | Domain d1zs5a2: 1zs5 A:719-832 [125589] Other proteins in same PDB: d1zs5a3 automated match to d1zs5a1 complexed with mib |
PDB Entry: 1zs5 (more details)
SCOPe Domain Sequences for d1zs5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zs5a2 a.29.2.1 (A:719-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} skeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlk nryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk
Timeline for d1zs5a2: