Lineage for d1zs5a1 (1zs5 A:715-832)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1267072Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1267073Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1267074Family a.29.2.1: Bromodomain [47371] (5 proteins)
  6. 1267088Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)
  7. 1267089Species Human (Homo sapiens) [TaxId:9606] [47376] (8 PDB entries)
  8. 1267093Domain d1zs5a1: 1zs5 A:715-832 [125589]
    automatically matched to d1jm4b_
    complexed with mib

Details for d1zs5a1

PDB Entry: 1zs5 (more details)

PDB Description: structure-based evaluation of selective and non-selective small molecules that block hiv-1 tat and pcaf association
PDB Compounds: (A:) Histone acetyltransferase PCAF

SCOPe Domain Sequences for d1zs5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zs5a1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
gshmskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktms
erlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk

SCOPe Domain Coordinates for d1zs5a1:

Click to download the PDB-style file with coordinates for d1zs5a1.
(The format of our PDB-style files is described here.)

Timeline for d1zs5a1: