| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.9: Bacteriophage CII protein [140520] (1 protein) Pfam PF05269; a compact helix-swapped dimer of the canonical fold; includes the extra C-terminal teramerisation region (alpha-helix); in the tetramer-DNA complex only two of the four HTH motifs interact with DNA |
| Protein Regulatory protein cII [140521] (1 species) |
| Species Bacteriophage lambda [TaxId:10710] [140522] (3 PDB entries) Uniprot P03042 2-80! Uniprot P03042 4-81 |
| Domain d1zs4d_: 1zs4 D: [125588] Other proteins in same PDB: d1zs4a2, d1zs4b3 automated match to d1zs4a1 protein/DNA complex |
PDB Entry: 1zs4 (more details), 1.7 Å
SCOPe Domain Sequences for d1zs4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zs4d_ a.35.1.9 (D:) Regulatory protein cII {Bacteriophage lambda [TaxId: 10710]}
rnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgvvddd
marlarqvaailt
Timeline for d1zs4d_: