SCOP 1.73: Domain d1zs4c1: 1zs4 C:4-81

Lineage for d1zs4c1 (1zs4 C:4-81)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.9: Bacteriophage CII protein [140520] (1 protein)
   Pfam PF05269; a compact helix-swapped dimer of the canonical fold; includes the extra C-terminal teramerisation region (alpha-helix); in the tetramer-DNA complex only two of the four HTH motifs interact with DNA

6. Protein Regulatory protein cII [140521] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [140522] (3 PDB entries)

8. Domain d1zs4c1: 1zs4 C:4-81 [125587]
   automatically matched to 1ZS4 A:4-81

Details for d1zs4c1

PDB Entry: 1zs4, 1.7 Å

PDB Description: Structure of bacteriophage lambda cII protein in complex with DNA

PDB Compounds: (C:) Regulatory protein CII

SCOP Domain Sequences for d1zs4c1:

Sequence; same for both SEQRES and ATOM records:

>d1zs4c1 a.35.1.9 (C:4-81) Regulatory protein cII {Bacteriophage lambda [TaxId: 10710]}
ankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgvv
dddmarlarqvaailtnk

Timeline for d1zs4c1:

• d1zs4c1 is new in SCOP 1.73
  
• d1zs4c1 appears in SCOP 1.75
  
• d1zs4c1 appears in the current release, SCOPe 2.08, called d1zs4c_