SCOPe 2.08: Domain d1zs4c_: 1zs4 C:

Lineage for d1zs4c_ (1zs4 C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.9: Bacteriophage CII protein [140520] (1 protein)
   Pfam PF05269; a compact helix-swapped dimer of the canonical fold; includes the extra C-terminal teramerisation region (alpha-helix); in the tetramer-DNA complex only two of the four HTH motifs interact with DNA

6. Protein Regulatory protein cII [140521] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [140522] (3 PDB entries)
   Uniprot P03042 2-80! Uniprot P03042 4-81

8. Domain d1zs4c_: 1zs4 C: [125587]
   Other proteins in same PDB: d1zs4a2, d1zs4b3
   automated match to d1zs4a1
   protein/DNA complex

Details for d1zs4c_

PDB Entry: 1zs4, 1.7 Å

PDB Description: Structure of bacteriophage lambda cII protein in complex with DNA

PDB Compounds: (C:) Regulatory protein CII

SCOPe Domain Sequences for d1zs4c_:

Sequence; same for both SEQRES and ATOM records:

>d1zs4c_ a.35.1.9 (C:) Regulatory protein cII {Bacteriophage lambda [TaxId: 10710]}
ankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgvv
dddmarlarqvaailtnkk

Timeline for d1zs4c_:

• d1zs4c_ first appeared in SCOP 1.73, called d1zs4c1
  
• d1zs4c_ appears in SCOPe 2.07