Lineage for d1zs4b2 (1zs4 B:4-81)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709704Family a.35.1.9: Bacteriophage CII protein [140520] (1 protein)
    Pfam PF05269; a compact helix-swapped dimer of the canonical fold; includes the extra C-terminal teramerisation region (alpha-helix); in the tetramer-DNA complex only two of the four HTH motifs interact with DNA
  6. 2709705Protein Regulatory protein cII [140521] (1 species)
  7. 2709706Species Bacteriophage lambda [TaxId:10710] [140522] (3 PDB entries)
    Uniprot P03042 2-80! Uniprot P03042 4-81
  8. 2709708Domain d1zs4b2: 1zs4 B:4-81 [125586]
    Other proteins in same PDB: d1zs4a2, d1zs4b3
    automated match to d1zs4a1
    protein/DNA complex

Details for d1zs4b2

PDB Entry: 1zs4 (more details), 1.7 Å

PDB Description: Structure of bacteriophage lambda cII protein in complex with DNA
PDB Compounds: (B:) Regulatory protein CII

SCOPe Domain Sequences for d1zs4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zs4b2 a.35.1.9 (B:4-81) Regulatory protein cII {Bacteriophage lambda [TaxId: 10710]}
ankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgvv
dddmarlarqvaailtnk

SCOPe Domain Coordinates for d1zs4b2:

Click to download the PDB-style file with coordinates for d1zs4b2.
(The format of our PDB-style files is described here.)

Timeline for d1zs4b2: