Lineage for d1zs3h1 (1zs3 H:3-173)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 638728Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 638887Species Lactococcus lactis, DpsB [TaxId:1358] [140433] (1 PDB entry)
  8. 638895Domain d1zs3h1: 1zs3 H:3-173 [125580]
    automatically matched to 1ZS3 A:3-173

Details for d1zs3h1

PDB Entry: 1zs3 (more details), 2.7 Å

PDB Description: the crystal structure of the lactococcus lactis mg1363 dpsb protein
PDB Compounds: (H:) Lactococcus lactis MG1363 DpsA

SCOP Domain Sequences for d1zs3h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zs3h1 a.25.1.1 (H:3-173) Dodecameric ferritin homolog {Lactococcus lactis, DpsB [TaxId: 1358]}
tklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkceylr
eiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfivdf
qaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadf

SCOP Domain Coordinates for d1zs3h1:

Click to download the PDB-style file with coordinates for d1zs3h1.
(The format of our PDB-style files is described here.)

Timeline for d1zs3h1: