![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Dodecameric ferritin homolog [47250] (16 species) |
![]() | Species Lactococcus lactis, DpsB [TaxId:1358] [140433] (1 PDB entry) Uniprot A2RJ45 3-173 |
![]() | Domain d1zs3g_: 1zs3 G: [125579] automated match to d1zs3a1 |
PDB Entry: 1zs3 (more details), 2.7 Å
SCOPe Domain Sequences for d1zs3g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zs3g_ a.25.1.1 (G:) Dodecameric ferritin homolog {Lactococcus lactis, DpsB [TaxId: 1358]} tklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkceylr eiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfivdf qaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadf
Timeline for d1zs3g_: