Lineage for d1zs3e_ (1zs3 E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701715Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2701920Species Lactococcus lactis, DpsB [TaxId:1358] [140433] (1 PDB entry)
    Uniprot A2RJ45 3-173
  8. 2701925Domain d1zs3e_: 1zs3 E: [125577]
    automated match to d1zs3a1

Details for d1zs3e_

PDB Entry: 1zs3 (more details), 2.7 Å

PDB Description: the crystal structure of the lactococcus lactis mg1363 dpsb protein
PDB Compounds: (E:) Lactococcus lactis MG1363 DpsA

SCOPe Domain Sequences for d1zs3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zs3e_ a.25.1.1 (E:) Dodecameric ferritin homolog {Lactococcus lactis, DpsB [TaxId: 1358]}
tklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkceylr
eiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfivdf
qaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadf

SCOPe Domain Coordinates for d1zs3e_:

Click to download the PDB-style file with coordinates for d1zs3e_.
(The format of our PDB-style files is described here.)

Timeline for d1zs3e_: