Lineage for d1zs2a2 (1zs2 A:1-554)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682153Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 682181Protein Amylosucrase [69384] (1 species)
  7. 682182Species Neisseria polysaccharea [TaxId:489] [69385] (10 PDB entries)
  8. 682190Domain d1zs2a2: 1zs2 A:1-554 [125572]
    Other proteins in same PDB: d1zs2a1
    automatically matched to d1g5aa2
    complexed with glc, suc; mutant

Details for d1zs2a2

PDB Entry: 1zs2 (more details), 2.16 Å

PDB Description: amylosucrase mutant e328q in a ternary complex with sucrose and maltoheptaose
PDB Compounds: (A:) amylosucrase

SCOP Domain Sequences for d1zs2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zs2a2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]}
spnsqylktrildiytpeqragieksedwrqfsrrmdthfpklmneldsvygnneallpm
lemllaqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglkdkip
yfqelgltylylmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheagisav
vdfifnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlreifpdqhpggfsql
edgrwvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdavafiwkqmgtsce
nlpqahalirafnavmriaapavffksqaivhpdqvvqyigqdecqigynplqmallwnt
latrevnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrqflnr
ffvnrfdgsfargvpfqynpstgdcrvsgtaaalvglaqddphavdrikllysialstgg
lpliylgdevgtlndddwsqdsnksddsrwahrprynealyaqrndpstaagqiyqglrh
miavrqsnprfdgg

SCOP Domain Coordinates for d1zs2a2:

Click to download the PDB-style file with coordinates for d1zs2a2.
(The format of our PDB-style files is described here.)

Timeline for d1zs2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zs2a1