Class b: All beta proteins [48724] (177 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Amylosucrase [69328] (1 species) |
Species Neisseria polysaccharea [TaxId:489] [69329] (10 PDB entries) |
Domain d1zs2a1: 1zs2 A:555-628 [125571] Other proteins in same PDB: d1zs2a2, d1zs2a3 automated match to d1mvya1 complexed with suc; mutant |
PDB Entry: 1zs2 (more details), 2.16 Å
SCOPe Domain Sequences for d1zs2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zs2a1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd ltlqpyqvmwleia
Timeline for d1zs2a1: