Lineage for d1zs2a1 (1zs2 A:555-628)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400341Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 protein domains)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2400358Protein Amylosucrase [69328] (1 species)
  7. 2400359Species Neisseria polysaccharea [TaxId:489] [69329] (10 PDB entries)
  8. 2400363Domain d1zs2a1: 1zs2 A:555-628 [125571]
    Other proteins in same PDB: d1zs2a2, d1zs2a3
    automated match to d1mvya1
    complexed with suc; mutant

Details for d1zs2a1

PDB Entry: 1zs2 (more details), 2.16 Å

PDB Description: amylosucrase mutant e328q in a ternary complex with sucrose and maltoheptaose
PDB Compounds: (A:) amylosucrase

SCOPe Domain Sequences for d1zs2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zs2a1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea [TaxId: 489]}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia

SCOPe Domain Coordinates for d1zs2a1:

Click to download the PDB-style file with coordinates for d1zs2a1.
(The format of our PDB-style files is described here.)

Timeline for d1zs2a1: